PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019839
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 335aa    MW: 35885.5 Da    PI: 8.1714
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019839genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.38.1e-4246123178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC++dls+ak+y++rhkvC +hsk+p+vlvsgl+qrfCqqCsrfh+l efD+ekrsCrrrLa+hnerrrk+q 
  DCAR_019839  46 RCQVEGCNVDLSDAKSYYSRHKVCAKHSKSPKVLVSGLHQRFCQQCSRFHHLPEFDQEKRSCRRRLAGHNERRRKPQV 123
                  6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-3340108IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.98344121IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.86E-3945125IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3247120IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0042127Biological Processregulation of cell proliferation
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MASASPNGFE IYFDDVGDGS SSAGGSPAKK GRGGGGAGAG AAQVSRCQVE GCNVDLSDAK  60
SYYSRHKVCA KHSKSPKVLV SGLHQRFCQQ CSRFHHLPEF DQEKRSCRRR LAGHNERRRK  120
PQVTSLLSAR YGSSSIFGND TGGGSFLMDF SAYPRHAGKV ESGSQDPGSG NFPPIPWRNN  180
PENPSPELQR SNKNITYPGH AIPPGGCFDG VSSDSSCALS LLSNNSRGSI NRSLSLGTNY  240
QMDTYGSHVV QPAATHGLNM SQFSSNSWGF KGNDESGSVS YDMHPELGLG QIPNPGTSQF  300
TGDLQMTQQS GKQCMDIQHP MGYDDSVQHM HWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3139120384squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00412DAPTransfer from AT3G57920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028954.11e-109Promoter-binding protein SPL9
TrEMBLA0A061EXC51e-109A0A061EXC5_THECC; Promoter-binding protein SPL9
STRINGVIT_08s0007g06270.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.15e-46squamosa promoter binding protein-like 15